Skip to content
Snippets Groups Projects
Commit 65b27e1c authored by Keyu Wang's avatar Keyu Wang
Browse files

Update file model.html

parent 7911db32
No related branches found
No related tags found
No related merge requests found
Pipeline #533616 passed
......@@ -410,22 +410,6 @@ pre{
<p></p>
<p>However, due to time and financial constraints, we are unable to validate this through further experiments at the moment. In the future, we plan to conduct ITC experiments or use assays like qPCR and Western Blot (WB) in <em>E. coli</em> to detect downstream products and verify our hypothesis.</p>
<h4 class="atx" id="sequence-of-protein">Sequence of Protein</h4>
<blockquote>
<p>sp|P17893|ARGR_BACSU Argininerepressor OS=Bacillus subtilis (strain 168) OX=224308 GN=argR PE=1 SV=1</p>
</blockquote>
<pre>MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELL</pre>
<blockquote>
<p>tr|G3XD77|G3XD77_PSEAEQuorum-sensing control repressor OS=Pseudomonas aeruginosa (strain ATCC 15692 /DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964GN=qscR PE=4 SV=1</p>
</blockquote>
<p><u><span>MHDEREGYLEILSRITTEEEFFSLVLEICGNYGFEFF</span></u><u><span>S</span></u><u><span>FG</span></u><u><span>ARAPFPLTAP</span></u>KYHFLSNYPGEWKSRYISEDYTSIDPIVRHGLLEYTPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRGKYGLISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEMLKWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLLN</p>
<blockquote>
<p>AhrC-like protein</p>
</blockquote>
<p>MNKGQRHIKIREIITSNEIETQDELVDMLKQDGYKVTQATVSRDIKELHLVKVPTNNGSYKYSLPADQRFNPLSKLKRALMDAFVKIDSASHMIVLKTMPGNAQAIGALMDNLDWDEMMGTICGDDTILIICRTPEDTEGVKNRLLELLSFGARAPFPLTAPKYHFLSNYPGEWKSRYISEDYTSIDPIVRHGLLEYTPLIWNGEDFQENRFFWEEALHHGIRHGWSIPVRGKYGLISMLSLVRSSESIAATEILEKESFLLWITSMLQATFGDLLAPRIVPESNVRLTARETEMLKWTAVGKTYGEIGLILSIDQRTVKFHIVNAMRKLNSSNKAEATMKAYAIGLLN</p>
<blockquote>
<p>DNA sequence that combine with protein</p>
</blockquote>
<p>CATGAATAAAAATTCAAG</p>
<pre><code class="fenced-code-block language-text">
&gt; sp|P17893|ARGR_BACSU Arginine repressor OS=Bacillus subtilis (strain 168) OX=224308 GN=argR PE=1 SV=1
......
0% Loading or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment