Skip to content
Snippets Groups Projects
Commit b52b14f4 authored by Wenxuan Miao's avatar Wenxuan Miao
Browse files

Update file model.html

parent b334089f
No related branches found
No related tags found
No related merge requests found
Pipeline #359204 canceled
......@@ -1272,7 +1272,7 @@ SGSGTDFTLSINSVEAEDFGMYFCQQTNSWPHTFGGG
<table>
<tr>
<td>anti_GM1_125.fasta</td>
<td>anti_GAD_MICA7.fasta</td>
<td>
<pre>
......
0% Loading or .
You are about to add 0 people to the discussion. Proceed with caution.
Finish editing this message first!
Please register or to comment